PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa08g058440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MYB
Protein Properties Length: 526aa    MW: 58645.6 Da    PI: 6.2673
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa08g058440.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.7e-173582148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed++l+d+v+++G g+W+++ ++ g+ R++k+c++rw ++l
   Csa08g058440.1 35 KGPWSSAEDDILIDYVNKHGEGNWNAVQKHTGLFRCGKSCRLRWANHL 82
                     79******************************************9986 PP

2Myb_DNA-binding53.65.2e-1788131146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v++++++G++ W++ a++++ gRt++++k++w++
   Csa08g058440.1  88 KGAFSQEEEQLIVELHAKMGNR-WARMAAHLP-GRTDNEIKNYWNT 131
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016931.4E-2641525IPR016310Transcription factor, GAMYB
PROSITE profilePS5129416.0383082IPR017930Myb domain
SuperFamilySSF466896.36E-3032129IPR009057Homeodomain-like
SMARTSM007176.5E-153484IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-233689IPR009057Homeodomain-like
CDDcd001671.34E-113782No hitNo description
PfamPF139219.5E-163898No hitNo description
PROSITE profilePS5129426.31683137IPR017930Myb domain
SMARTSM007172.7E-1787135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2590136IPR009057Homeodomain-like
CDDcd001671.36E-1290131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MSNTSTDSDH NESPATDDNN GSDCRSRWER SGLKKGPWSS AEDDILIDYV NKHGEGNWNA  60
VQKHTGLFRC GKSCRLRWAN HLRPNLKKGA FSQEEEQLIV ELHAKMGNRW ARMAAHLPGR  120
TDNEIKNYWN TRIKRRQRAG LPLYPPEMHL EVLEWSQEYA KSRLMAEDRR HSDFLQLGSC  180
ESNVFFDNLN FVTDMAPGAS DLADMTAYKN LANAASSPRY ENFMTPMMPC SKRFWESELL  240
YPGCSSAIKQ EFPSPEQFQN TSSPQKISKT CSFSVPCHVD HPLYGNQQHS PVVIPDSHTL  300
TGGIVPSSKP SSYGAVKLEL PSFQYSETTF DQWKKSSSPP HSDLLDPFDA YIHSPPPPTG  360
RQESYCFSNC DTGLLDMLLL EAKIRNSTTK NDLYKSCAST IPPADLGEVT VSQTKSEEFD  420
NSLKTLVHSE ISTQQNADGI PPRQREKRRK PLLDITRPDV LLASSWLDHG LGIAKESGSM  480
SDALTVLLGD DIGNEYMHTS VGASSGVGSC SWSNMPPVCQ MTELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-312413613127MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4119690.0AF411969.1 Arabidopsis thaliana putative transcription factor MYB33 (MYB33) mRNA, complete cds.
GenBankAK1189370.0AK118937.1 Arabidopsis thaliana At5g06100 mRNA for putative transcription factor MYB33, complete cds, clone: RAFL21-27-I01.
GenBankAY5196160.0AY519616.1 Arabidopsis thaliana MYB transcription factor (At5g06100) mRNA, complete cds.
GenBankBT0060490.0BT006049.1 Arabidopsis thaliana clone U51311 putative MYB family transcription factor (At5g06100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010423386.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_010423387.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLR0H6G30.0R0H6G3_9BRAS; Transcription factor
STRINGfgenesh2_kg.6__546__AT5G06100.30.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.30.0myb domain protein 33